Crossover junction endonuclease EME1 (EME1) antibody

Catalog No. ABIN631761

This anti- antibody is a Rabbit Polyclonal antibody detecting in WB. Suitable for Human and Mouse.

Quick Overview for Crossover junction endonuclease EME1 (EME1) antibody (ABIN631761)

Target: Crossover junction endonuclease EME1 (EME1)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Purification: Affinity purified

Immunogen: EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EME1 Blocking Peptide, (ABIN5613363), is also available for use as a blocking control in assays to test for specificity of this EME1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EME1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Crossover junction endonuclease EME1 (EME1)

Alternative Name: EME1

Background: EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.

Molecular Weight: 63 kDa (MW of target protein)