Crossover junction endonuclease EME1 (EME1) antibody
-
- Target See all Crossover junction endonuclease EME1 (EME1) Antibodies
- Crossover junction endonuclease EME1 (EME1)
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS
- Top Product
- Discover our top product EME1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EME1 Blocking Peptide, catalog no. 33R-5688, is also available for use as a blocking control in assays to test for specificity of this EME1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EME1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Crossover junction endonuclease EME1 (EME1)
- Alternative Name
- EME1 (EME1 Products)
- Background
- EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.
- Molecular Weight
- 63 kDa (MW of target protein)
-