APOH antibody
-
- Target See all APOH Antibodies
- APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APOH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG
- Top Product
- Discover our top product APOH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ApoH Blocking Peptide, catalog no. 33R-7270, is also available for use as a blocking control in assays to test for specificity of this ApoH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))
- Alternative Name
- ApoH (APOH Products)
- Synonyms
- B2G1 antibody, B2GP1 antibody, BG antibody, BETA2 antibody, BHF-1 antibody, MODY6 antibody, NEUROD antibody, bHLHa3 antibody, apoh antibody, APOH antibody, B2GPI antibody, beta-2-GPI antibody, beta2-GPI antibody, LOC100227913 antibody, apolipoprotein H antibody, neuronal differentiation 1 antibody, APOH antibody, NEUROD1 antibody, apoh antibody, Apoh antibody
- Background
- Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies.
- Molecular Weight
- 36 kDa (MW of target protein)
-