RAD17 antibody

Catalog No. ABIN631819

Product Details anti-RAD17 Antibody

Target: RAD17

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD17 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD17 Blocking Peptide, catalog no. 33R-6262, is also available for use as a blocking control in assays to test for specificity of this RAD17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD17

Target: RAD17

Alternative Name: RAD17 (RAD17 Products)

Background: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs.

Molecular Weight: 76 kDa (MW of target protein)