NOP16 antibody (Middle Region)

Catalog No. ABIN631833

Product Details anti-NOP16 Antibody

Target: NOP16 (Nucleolar Protein 16 (NOP16))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOP16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HSPC111 antibody was raised against the middle region of HSPC111

Purification: Affinity purified

Immunogen: HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPC111 Blocking Peptide, catalog no. 33R-8012, is also available for use as a blocking control in assays to test for specificity of this HSPC111 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPC111 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOP16

Target: NOP16 (Nucleolar Protein 16 (NOP16))

Alternative Name: HSPC111 (NOP16 Products)

Synonyms: zgc:92910 antibody, HSPC111 antibody, HSPC185 antibody, AA409471 antibody, D13Wsu177e antibody, RGD1305727 antibody, NOP16 nucleolar protein homolog (yeast) antibody, 66S preribosome component NOP16 antibody, NOP16 nucleolar protein antibody, NOP16 nucleolar protein S homeolog antibody, hypothetical protein antibody, nop16 antibody, ANI_1_620034 antibody, BDBG_00770 antibody, AOR_1_1422114 antibody, TERG_00604 antibody, NOP16 antibody, Nop16 antibody, nop16.S antibody, CAALFM_C209660WA antibody

Background: NOP16 is transcriptionally regulated by c-Myc, upregulated in breast cancer, and overexpression is associated with poor patient survival.

Molecular Weight: 21 kDa (MW of target protein)