C19orf47 antibody (C-Term)

Catalog No. ABIN631889

Product Details anti-C19orf47 Antibody

Target: C19orf47 (Chromosome 19 Open Reading Frame 47 (C19orf47))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C19orf47 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C19 ORF47 antibody was raised against the C terminal Of C19 rf47

Purification: Affinity purified

Immunogen: C19 ORF47 antibody was raised using the C terminal Of C19 rf47 corresponding to a region with amino acids DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKR

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19ORF47 Blocking Peptide, catalog no. 33R-2176, is also available for use as a blocking control in assays to test for specificity of this C19ORF47 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C19orf47

Target: C19orf47 (Chromosome 19 Open Reading Frame 47 (C19orf47))

Alternative Name: C19ORF47 (C19orf47 Products)

Synonyms: MGC79696 antibody, chromosome 19 open reading frame 47 antibody, chromosome 19 open reading frame 47 L homeolog antibody, RIKEN cDNA 2310022A10 gene antibody, similar to CG16812-PA antibody, chromosome 18 open reading frame, human C19orf47 antibody, C19orf47 antibody, c19orf47.L antibody, c19orf47 antibody, 2310022A10Rik antibody, RGD1307554 antibody, C18H19orf47 antibody

Background: The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 38 kDa (MW of target protein)