ODF3L1 antibody (N-Term)

Catalog No. ABIN631891

Product Details anti-ODF3L1 Antibody

Target: ODF3L1 (Outer Dense Fiber of Sperm Tails 3-Like 1 (ODF3L1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ODF3L1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ODF3 L1 antibody was raised against the N terminal of ODF3 1

Purification: Affinity purified

Immunogen: ODF3 L1 antibody was raised using the N terminal of ODF3 1 corresponding to a region with amino acids KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ODF3L1 Blocking Peptide, catalog no. 33R-4527, is also available for use as a blocking control in assays to test for specificity of this ODF3L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ODF3L1

Target: ODF3L1 (Outer Dense Fiber of Sperm Tails 3-Like 1 (ODF3L1))

Alternative Name: ODF3L1 (ODF3L1 Products)

Synonyms: BC049697 antibody, Gm1116 antibody, outer dense fiber of sperm tails 3 like 1 antibody, outer dense fiber of sperm tails 3-like 1 antibody, ODF3L1 antibody, Odf3l1 antibody

Background: The function of ODF3L1 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 31 kDa (MW of target protein)