IQCE antibody (Middle Region)
-
- Target See all IQCE products
- IQCE (IQ Motif Containing E (IQCE))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IQCE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IQCE antibody was raised against the middle region of IQCE
- Purification
- Affinity purified
- Immunogen
- IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IQCE Blocking Peptide, catalog no. 33R-4484, is also available for use as a blocking control in assays to test for specificity of this IQCE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IQCE (IQ Motif Containing E (IQCE))
- Alternative Name
- IQCE (IQCE Products)
- Synonyms
- 1700028P05Rik antibody, mKIAA1023 antibody, RGD1311349 antibody, IQ motif containing E antibody, IQCE antibody, Iqce antibody
- Background
- IQCE contains 2 IQ domains. The functions of IQCE remain unknown.
- Molecular Weight
- 77 kDa (MW of target protein)
-