IQCE antibody (Middle Region)

Catalog No. ABIN631892

Product Details anti-IQCE Antibody

Target: IQCE (IQ Motif Containing E (IQCE))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IQCE antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IQCE antibody was raised against the middle region of IQCE

Purification: Affinity purified

Immunogen: IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IQCE Blocking Peptide, catalog no. 33R-4484, is also available for use as a blocking control in assays to test for specificity of this IQCE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IQCE

Target: IQCE (IQ Motif Containing E (IQCE))

Alternative Name: IQCE (IQCE Products)

Synonyms: 1700028P05Rik antibody, mKIAA1023 antibody, RGD1311349 antibody, IQ motif containing E antibody, IQCE antibody, Iqce antibody

Background: IQCE contains 2 IQ domains. The functions of IQCE remain unknown.

Molecular Weight: 77 kDa (MW of target protein)