CAPZA3 antibody

Catalog No. ABIN631921

This Rabbit Polyclonal antibody specifically detects CAPZA3 in WB. It exhibits reactivity toward Human.

Quick Overview for CAPZA3 antibody (ABIN631921)

Target: CAPZA3 (Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAPZA3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CAPZA3 Antibody

Purification: Affinity purified

Immunogen: CAPZA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAPZA3 Blocking Peptide, (ABIN5612605), is also available for use as a blocking control in assays to test for specificity of this CAPZA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPZA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAPZA3

Target: CAPZA3 (Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3))

Alternative Name: CAPZA3

Background: F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization