GCLM antibody (Glutamate-Cysteine Ligase, Modifier Subunit) (Middle Region)

Details for Product anti-GCLM Antibody No. ABIN631928
Antigen
  • Glclr
  • GLCLR
  • id:ibd3182
  • wu:fi24c07
  • zgc:55903
  • AI649393
  • Gcmc
  • glutamate-cysteine ligase regulatory subunit
  • glutamate cysteine ligase, modifier subunit
  • glutamate-cysteine ligase modifier subunit
  • glutamate-cysteine ligase, modifier subunit
  • glutamate-cysteine ligase, modifier subunit L homeolog
  • PTRG_09814
  • Gclm
  • GCLM
  • gclm
  • gclm.L
Epitope
Middle Region
20
10
9
9
4
2
2
2
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
100
50
39
5
3
2
2
2
2
2
1
1
Host
Rabbit
84
23
Clonality
Polyclonal
Conjugate
This GCLM antibody is un-conjugated
6
3
3
3
3
3
3
3
3
2
2
2
Application
Western Blotting (WB)
81
42
42
26
22
14
12
10
10
5
4
2
2
Options
Immunogen GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
Specificity GCLM antibody was raised against the middle region of GCLM
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others GCLM products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name GCLM (GCLM Antibody Abstract)
Background Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis.
Molecular Weight 31 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

GCLM Blocking Peptide, catalog no. 33R-4592, is also available for use as a blocking control in assays to test for specificity of this GCLM antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLM antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Did you look for something else?