MGMT antibody (Middle Region)
-
- Target See all MGMT Antibodies
- MGMT (O6-Methylguanine-DNA-Methyltransferase (MGMT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MGMT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MGMT antibody was raised against the middle region of MGMT
- Purification
- Affinity purified
- Immunogen
- MGMT antibody was raised using the middle region of MGMT corresponding to a region with amino acids ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG
- Top Product
- Discover our top product MGMT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MGMT Blocking Peptide, catalog no. 33R-4170, is also available for use as a blocking control in assays to test for specificity of this MGMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MGMT (O6-Methylguanine-DNA-Methyltransferase (MGMT))
- Alternative Name
- MGMT (MGMT Products)
- Background
- MGMT is involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA.MGMT repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- DNA Damage Repair, Positive Regulation of Response to DNA Damage Stimulus
-