Syntaxin 19 antibody (N-Term)

Catalog No. ABIN631981

Product Details anti-Syntaxin 19 Antibody

Target: Syntaxin 19 (STX19)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Syntaxin 19 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Syntaxin 19 antibody was raised against the N terminal of STX19

Purification: Affinity purified

Immunogen: Syntaxin 19 antibody was raised using the N terminal of STX19 corresponding to a region with amino acids LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Syntaxin 19 Blocking Peptide, catalog no. 33R-5327, is also available for use as a blocking control in assays to test for specificity of this Syntaxin 19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STX19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Syntaxin 19

Target: Syntaxin 19 (STX19)

Alternative Name: Syntaxin 19 (STX19 Products)

Synonyms: A030009B12Rik antibody, syntaxin 19 antibody, syntaxin 19 L homeolog antibody, STX19 antibody, stx19.L antibody, stx19 antibody, Stx19 antibody

Background: The function of Syntaxin 19 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 34 kDa (MW of target protein)