C11orf46 antibody (N-Term)

Catalog No. ABIN631992

Product Details anti-C11orf46 Antibody

Target: C11orf46 (Chromosome 11 Open Reading Frame 46 (C11orf46))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C11orf46 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C11 ORF46 antibody was raised against the N terminal Of C11 rf46

Purification: Affinity purified

Immunogen: C11 ORF46 antibody was raised using the N terminal Of C11 rf46 corresponding to a region with amino acids SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C11ORF46 Blocking Peptide, catalog no. 33R-8831, is also available for use as a blocking control in assays to test for specificity of this C11ORF46 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C11orf46

Target: C11orf46 (Chromosome 11 Open Reading Frame 46 (C11orf46))

Alternative Name: C11ORF46 (C11orf46 Products)

Synonyms: MGC115732 antibody, ARF7EP antibody, C11orf46 antibody, dJ299F11.1 antibody, 2700007P21Rik antibody, 4930448O08Rik antibody, RGD1311463 antibody, C15H11orf46 antibody, ARL14EP antibody, ADP ribosylation factor like GTPase 14 effector protein L homeolog antibody, ADP ribosylation factor like GTPase 14 effector protein antibody, ADP-ribosylation factor-like 14 effector protein antibody, ADP-ribosylation factor like GTPase 14 effector protein antibody, arl14ep.L antibody, arl14ep antibody, ARL14EP antibody, Arl14ep antibody

Background: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 29 kDa (MW of target protein)