NOC3L antibody

Catalog No. ABIN632009

Product Details anti-NOC3L Antibody

Target: NOC3L (Nucleolar Complex Associated 3 Homolog (NOC3L))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOC3L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NOC3 L antibody was raised using a synthetic peptide corresponding to a region with amino acids TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOC3L Blocking Peptide, catalog no. 33R-9174, is also available for use as a blocking control in assays to test for specificity of this NOC3L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOC3L

Target: NOC3L (Nucleolar Complex Associated 3 Homolog (NOC3L))

Alternative Name: NOC3L (NOC3L Products)

Synonyms: AD24 antibody, C10orf117 antibody, FAD24 antibody, AF233884 antibody, Fad24 antibody, RGD1560656 antibody, NOC3 protein homolog antibody, c10orf117 antibody, cb522 antibody, sb:cb522 antibody, NOC3 like DNA replication regulator antibody, NOC3-like DNA replication regulator S homeolog antibody, NOC3-like DNA replication regulator antibody, nucleolar complex associated 3 homolog (S. cerevisiae) antibody, NOC3L antibody, Noc3l antibody, noc3l.S antibody, noc3l antibody

Background: NOC3L belongs to the CBF/MAK21 family. It may be required for adipogenesis.

Molecular Weight: 92 kDa (MW of target protein)