TPD52L3 antibody (Middle Region)

Catalog No. ABIN632010

Product Details anti-TPD52L3 Antibody

Target: TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPD52L3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TPD52 L3 antibody was raised against the middle region of TPD52 3

Purification: Affinity purified

Immunogen: TPD52 L3 antibody was raised using the middle region of TPD52 3 corresponding to a region with amino acids GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPD52L3 Blocking Peptide, catalog no. 33R-3418, is also available for use as a blocking control in assays to test for specificity of this TPD52L3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPD50 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPD52L3

Target: TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))

Alternative Name: TPD52L3 (TPD52L3 Products)

Synonyms: NYDSP25 antibody, hD55 antibody, 4931412G03Rik antibody, Trpd52l3 antibody, RGD1309391 antibody, TPD52L3 antibody, TRPD52L3 antibody, tumor protein D52 like 3 antibody, tumor protein D52-like 3 antibody, TPD52L3 antibody, Trpd52l3 antibody, Tpd52l3 antibody

Background: TPD52L3 encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.

Molecular Weight: 15 kDa (MW of target protein)