RAB40C antibody (N-Term)

Catalog No. ABIN632024

Product Details anti-RAB40C Antibody

Target: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB40C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB40 C antibody was raised against the N terminal of RAB40

Purification: Affinity purified

Immunogen: RAB40 C antibody was raised using the N terminal of RAB40 corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB40C Blocking Peptide, catalog no. 33R-7497, is also available for use as a blocking control in assays to test for specificity of this RAB40C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB40C

Target: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Alternative Name: RAB40C (RAB40C Products)

Synonyms: RAB40C antibody, cb453 antibody, wu:fk50d06 antibody, zgc:136966 antibody, RARL antibody, RASL8C antibody, RAR3 antibody, Rab40c, member RAS oncogene family antibody, RAB40C, member RAS oncogene family antibody, RAB40c, member RAS oncogene family antibody, Rab40C, member RAS oncogene family antibody, Rab40c antibody, RAB40C antibody, rab40c antibody

Background: RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molecular Weight: 31 kDa (MW of target protein)