VPS53 antibody

Catalog No. ABIN632054

Product Details anti-VPS53 Antibody

Target: VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS53 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VPS53 antibody was raised using a synthetic peptide corresponding to a region with amino acids VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS53 Blocking Peptide, catalog no. 33R-9919, is also available for use as a blocking control in assays to test for specificity of this VPS53 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS53

Target: VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))

Alternative Name: VPS53 (VPS53 Products)

Synonyms: wu:fb77d11 antibody, zgc:103741 antibody, DKFZp469N152 antibody, 2010002A08Rik antibody, 2310040I21Rik antibody, 3100002B05Rik antibody, Hccs1 antibody, HCCS1 antibody, hVps53L antibody, pp13624 antibody, RGD1311391 antibody, VPS53, GARP complex subunit antibody, vacuolar protein sorting 53 homolog (S. cerevisiae) antibody, vacuolar protein sorting 53 antibody, VPS53 GARP complex subunit antibody, VPS53 antibody, vps53 antibody, PAAG_00802 antibody, MCYG_06020 antibody, VDBG_07188 antibody, MGYG_05943 antibody, Vps53 antibody

Background: This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.

Molecular Weight: 92 kDa (MW of target protein)