Calpain S1 antibody (Middle Region)

Catalog No. ABIN632073

Product Details anti-Calpain S1 Antibody

Target: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calpain S1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Calpain 4 antibody was raised against the middle region of CAPNS1

Purification: Affinity purified

Immunogen: Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calpain 4 Blocking Peptide, catalog no. 33R-8169, is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPNS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calpain S1

Target: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Alternative Name: Calpain 4 (CAPNS1 Products)

Synonyms: 30K antibody, CALPAIN4 antibody, CANP antibody, CANPS antibody, CAPN4 antibody, CDPS antibody, CSS1 antibody, Capn4 antibody, CAPNS1 antibody, Capa-4 antibody, Capa4 antibody, D7Ertd146e antibody, MGC84330 antibody, capns1 antibody, cb616 antibody, wu:fb81g08 antibody, wu:fl09e04 antibody, zgc:110603 antibody, calpain small subunit 1 antibody, calpain, small subunit 1 antibody, calpain, small subunit 1 L homeolog antibody, calpain, small subunit 1 a antibody, CAPNS1 antibody, Capns1 antibody, capns1.L antibody, capns1a antibody

Background: Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Apoptosis