C12orf4 antibody (N-Term)

Catalog No. ABIN632079

Product Details anti-C12orf4 Antibody

Target: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C12orf4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C12 ORF4 antibody was raised against the N terminal Of C12 rf4

Purification: Affinity purified

Immunogen: C12 ORF4 antibody was raised using the N terminal Of C12 rf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C12ORF4 Blocking Peptide, catalog no. 33R-2390, is also available for use as a blocking control in assays to test for specificity of this C12ORF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C12orf4

Target: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Alternative Name: C12ORF4 (C12orf4 Products)

Synonyms: MGC53313 antibody, C12orf4 antibody, MGC79726 antibody, chromosome 12 open reading frame 4 L homeolog antibody, chromosome 1 open reading frame, human C12orf4 antibody, chromosome 12 open reading frame 4 antibody, chromosome 11 open reading frame, human C12orf4 antibody, chromosome 12 open reading frame, human C12orf4 antibody, DNA segment, Chr 6, Wayne State University 163, expressed antibody, c12orf4.L antibody, C1H12ORF4 antibody, c12orf4 antibody, C11H12orf4 antibody, C12H12orf4 antibody, C12orf4 antibody, D6Wsu163e antibody

Background: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 64 kDa (MW of target protein)