LSM14A antibody
-
- Target See all LSM14A Antibodies
- LSM14A (LSM14A, SCD6 Homolog A (LSM14A))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LSM14A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LSM14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP
- Top Product
- Discover our top product LSM14A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LSM14A Blocking Peptide, catalog no. 33R-9285, is also available for use as a blocking control in assays to test for specificity of this LSM14A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LSM14A (LSM14A, SCD6 Homolog A (LSM14A))
- Alternative Name
- LSM14A (LSM14A Products)
- Synonyms
- C19orf13 antibody, FAM61A antibody, RAP55 antibody, RAP55A antibody, 2700023B17Rik antibody, AA407828 antibody, AU017544 antibody, Tral antibody, RGD1305695 antibody, fam61a antibody, lsm14a antibody, wu:fj52e11 antibody, zgc:63681 antibody, zgc:66203 antibody, zgc:77302 antibody, rap55 antibody, RAP55A-A antibody, rap55a antibody, xRAP55 antibody, xRAP55A antibody, RAP55A-B antibody, wu:fc55d12 antibody, zgc:55754 antibody, zgc:77202 antibody, LSM14A, mRNA processing body assembly factor antibody, LSM14A mRNA processing body assembly factor antibody, LSM14A mRNA processing body assembly factor a antibody, LSM14A mRNA processing body assembly factor L homeolog antibody, LSM14A mRNA processing body assembly factor S homeolog antibody, LSM14A mRNA processing body assembly factor b antibody, LSM14A antibody, Lsm14a antibody, lsm14aa antibody, lsm14a antibody, lsm14a.L antibody, lsm14a.S antibody, lsm14ab antibody
- Background
- Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Ribonucleoprotein Complex Subunit Organization
-