LSM14A antibody

Catalog No. ABIN632116

Product Details anti-LSM14A Antibody

Target: LSM14A (LSM14A, SCD6 Homolog A (LSM14A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LSM14A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LSM14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LSM14A Blocking Peptide, catalog no. 33R-9285, is also available for use as a blocking control in assays to test for specificity of this LSM14A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LSM14A

Target: LSM14A (LSM14A, SCD6 Homolog A (LSM14A))

Alternative Name: LSM14A (LSM14A Products)

Synonyms: C19orf13 antibody, FAM61A antibody, RAP55 antibody, RAP55A antibody, 2700023B17Rik antibody, AA407828 antibody, AU017544 antibody, Tral antibody, RGD1305695 antibody, fam61a antibody, lsm14a antibody, wu:fj52e11 antibody, zgc:63681 antibody, zgc:66203 antibody, zgc:77302 antibody, rap55 antibody, RAP55A-A antibody, rap55a antibody, xRAP55 antibody, xRAP55A antibody, RAP55A-B antibody, wu:fc55d12 antibody, zgc:55754 antibody, zgc:77202 antibody, LSM14A, mRNA processing body assembly factor antibody, LSM14A mRNA processing body assembly factor antibody, LSM14A mRNA processing body assembly factor a antibody, LSM14A mRNA processing body assembly factor L homeolog antibody, LSM14A mRNA processing body assembly factor S homeolog antibody, LSM14A mRNA processing body assembly factor b antibody, LSM14A antibody, Lsm14a antibody, lsm14aa antibody, lsm14a antibody, lsm14a.L antibody, lsm14a.S antibody, lsm14ab antibody

Background: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Ribonucleoprotein Complex Subunit Organization