CCDC63 antibody (Middle Region)

Catalog No. ABIN632141

Product Details anti-CCDC63 Antibody

Target: CCDC63 (Coiled-Coil Domain Containing 63 (CCDC63))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC63 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC63 antibody was raised against the middle region of CCDC63

Purification: Affinity purified

Immunogen: CCDC63 antibody was raised using the middle region of CCDC63 corresponding to a region with amino acids EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC63 Blocking Peptide, catalog no. 33R-2679, is also available for use as a blocking control in assays to test for specificity of this CCDC63 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC63

Target: CCDC63 (Coiled-Coil Domain Containing 63 (CCDC63))

Alternative Name: CCDC63 (CCDC63 Products)

Synonyms: ODA5 antibody, 4921511C16Rik antibody, coiled-coil domain containing 63 antibody, CCDC63 antibody, Ccdc63 antibody

Background: The function of CCDC63 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 66 kDa (MW of target protein)