SS18L1 antibody (Middle Region)
-
- Target See all SS18L1 Antibodies
- SS18L1 (Synovial Sarcoma Translocation Gene On Chromosome 18-Like 1 (SS18L1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SS18L1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SS18 L1 antibody was raised against the middle region of SS18 1
- Purification
- Affinity purified
- Immunogen
- SS18 L1 antibody was raised using the middle region of SS18 1 corresponding to a region with amino acids EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ
- Top Product
- Discover our top product SS18L1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SS18L1 Blocking Peptide, catalog no. 33R-2833, is also available for use as a blocking control in assays to test for specificity of this SS18L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SS10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SS18L1 (Synovial Sarcoma Translocation Gene On Chromosome 18-Like 1 (SS18L1))
- Alternative Name
- SS18L1 (SS18L1 Products)
- Synonyms
- crest antibody, CREST antibody, LP2261 antibody, A230053O16Rik antibody, SS18L1, nBAF chromatin remodeling complex subunit antibody, synovial sarcoma translocation gene on chromosome 18-like 1 antibody, synovial sarcoma translocation gene on chromosome 18-like 1 S homeolog antibody, SS18, nBAF chromatin remodeling complex subunit like 1 antibody, SS18L1 antibody, ss18l1 antibody, ss18l1.S antibody, Ss18l1 antibody
- Background
- Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X,18)(p11.2,q11.2), in which the 5-prime end of the SS18 gene is fused in-frame to the 3-prime end of the SSX1, SSX2, or SSX4 gene. The SS18L1 gene is homologous to SS18.
- Molecular Weight
- 43 kDa (MW of target protein)
-