TRIB3 antibody

Catalog No. ABIN632145

The Rabbit Polyclonal anti-TRIB3 antibody (ABIN632145) specifically detects TRIB3 in WB. The antibody is reactive with Human samples.

Quick Overview for TRIB3 antibody (ABIN632145)

Target: TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIB3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRIB3 Antibody

Purification: Affinity purified

Immunogen: TRIB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIB3 Blocking Peptide, (ABIN936257), is also available for use as a blocking control in assays to test for specificity of this TRIB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIB3

Target: TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))

Alternative Name: TRIB3

Background: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha