LETM2 antibody (N-Term)
-
- Target See all LETM2 Antibodies
- LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LETM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LETM2 antibody was raised against the N terminal of LETM2
- Purification
- Affinity purified
- Immunogen
- LETM2 antibody was raised using the N terminal of LETM2 corresponding to a region with amino acids KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK
- Top Product
- Discover our top product LETM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LETM2 Blocking Peptide, catalog no. 33R-4578, is also available for use as a blocking control in assays to test for specificity of this LETM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))
- Alternative Name
- LETM2 (LETM2 Products)
- Synonyms
- 6030453H13 antibody, D030041N04Rik antibody, LETM2S antibody, leucine zipper and EF-hand containing transmembrane protein 2 antibody, leucine zipper-EF-hand containing transmembrane protein 2 antibody, LETM2 antibody, Letm2 antibody
- Background
- LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.
- Molecular Weight
- 45 kDa (MW of target protein)
-