-
- Target See all LIX1 Antibodies
- LIX1 (Lix1 Homolog (LIX1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LIX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LIX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES
- Top Product
- Discover our top product LIX1 Primary Antibody
-
anti-Lix1 Homolog (LIX1) (AA 1-282) antibody
LIX1 Reactivity: Human ELISA, WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Lix1 Homolog (LIX1) (AA 221-250), (C-Term) antibodyLIX1 Reactivity: Human, Mouse WB Host: Rabbit Polyclonal RB28661 unconjugated
anti-Lix1 Homolog (LIX1) (AA 71-120) antibodyLIX1 Reactivity: Human, Mouse, Rat, Pig, Rabbit, Cow, Dog, Horse, Zebrafish (Danio rerio), Monkey, Bat, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LIX1 Blocking Peptide, catalog no. 33R-9181, is also available for use as a blocking control in assays to test for specificity of this LIX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIX1 (Lix1 Homolog (LIX1))
- Alternative Name
- LIX1 (LIX1 Products)
- Synonyms
- 5730466L18Rik antibody, si:ch211-236k19.8 antibody, C5orf11 antibody, limb and CNS expressed 1 antibody, Lix1 antibody, LIX1 antibody, lix1 antibody
- Background
- The function of LIX1 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 32 kDa (MW of target protein)
-
You are here:
