C1orf103 antibody (Middle Region)
-
- Target See all C1orf103 Antibodies
- C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C1orf103 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 ORF103 antibody was raised against the middle region of C1 rf103
- Purification
- Affinity purified
- Immunogen
- C1 ORF103 antibody was raised using the middle region of C1 rf103 corresponding to a region with amino acids SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT
- Top Product
- Discover our top product C1orf103 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1ORF103 Blocking Peptide, catalog no. 33R-8517, is also available for use as a blocking control in assays to test for specificity of this C1ORF103 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF103 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))
- Alternative Name
- C1ORF103 (C1orf103 Products)
- Synonyms
- C1orf103 antibody, RIF1 antibody, RP11-96K19.1 antibody, 2010012G17Rik antibody, 4933421E11Rik antibody, AI450568 antibody, Rif1 antibody, RGD1306520 antibody, ligand dependent nuclear receptor interacting factor 1 antibody, LRIF1 antibody, Lrif1 antibody
- Background
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 85 kDa (MW of target protein)
- Pathways
- Nuclear Hormone Receptor Binding
-