CCDC25 antibody (Middle Region)
-
- Target See all CCDC25 Antibodies
- CCDC25 (Coiled-Coil Domain Containing 25 (CCDC25))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCDC25 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CCDC25 antibody was raised against the middle region of CCDC25
- Purification
- Affinity purified
- Immunogen
- CCDC25 antibody was raised using the middle region of CCDC25 corresponding to a region with amino acids DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV
- Top Product
- Discover our top product CCDC25 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCDC25 Blocking Peptide, catalog no. 33R-2035, is also available for use as a blocking control in assays to test for specificity of this CCDC25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC25 (Coiled-Coil Domain Containing 25 (CCDC25))
- Alternative Name
- CCDC25 (CCDC25 Products)
- Synonyms
- 2610528H13Rik antibody, NSrp70 antibody, RGD1307689 antibody, coiled-coil domain containing 25 antibody, CCDC25 antibody, Ccdc25 antibody
- Background
- The function of CCDC25 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 24 kDa (MW of target protein)
-