CCDC25 antibody (Middle Region)

Catalog No. ABIN632195

Product Details anti-CCDC25 Antibody

Target: CCDC25 (Coiled-Coil Domain Containing 25 (CCDC25))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC25 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC25 antibody was raised against the middle region of CCDC25

Purification: Affinity purified

Immunogen: CCDC25 antibody was raised using the middle region of CCDC25 corresponding to a region with amino acids DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC25 Blocking Peptide, catalog no. 33R-2035, is also available for use as a blocking control in assays to test for specificity of this CCDC25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC25

Target: CCDC25 (Coiled-Coil Domain Containing 25 (CCDC25))

Alternative Name: CCDC25 (CCDC25 Products)

Synonyms: 2610528H13Rik antibody, NSrp70 antibody, RGD1307689 antibody, coiled-coil domain containing 25 antibody, CCDC25 antibody, Ccdc25 antibody

Background: The function of CCDC25 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 24 kDa (MW of target protein)