DPP3 antibody (N-Term)

Catalog No. ABIN632199

Product Details anti-DPP3 Antibody

Target: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DPP3 antibody was raised against the N terminal of DPP3

Purification: Affinity purified

Immunogen: DPP3 antibody was raised using the N terminal of DPP3 corresponding to a region with amino acids SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPP3 Blocking Peptide, catalog no. 33R-8738, is also available for use as a blocking control in assays to test for specificity of this DPP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPP3

Target: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Alternative Name: DPP3 (DPP3 Products)

Synonyms: DPPIII antibody, dppiii antibody, MGC68828 antibody, dpp3 antibody, MGC79125 antibody, DKFZp469J1915 antibody, 4930533O14Rik antibody, C86324 antibody, CG7415 antibody, DPP antibody, DPP III antibody, Dmel\\CG7415 antibody, wu:fb64b04 antibody, zgc:86791 antibody, dipeptidyl peptidase 3 antibody, dipeptidylpeptidase 3 antibody, dipeptidyl-peptidase 3 S homeolog antibody, dipeptidyl-peptidase 3 L homeolog antibody, dipeptidyl-peptidase 3 antibody, Dipeptidyl aminopeptidase III antibody, DPP3 antibody, Dpp3 antibody, dpp3.S antibody, dpp3.L antibody, CpipJ_CPIJ005356 antibody, PTRG_00518 antibody, MCYG_01338 antibody, MGYG_01882 antibody, dpp3 antibody, DppIII antibody

Background: DPP3 is a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers.

Molecular Weight: 82 kDa (MW of target protein)