HAGH antibody (C-Term)

Catalog No. ABIN632208

Product Details anti-HAGH Antibody

Target: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAGH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HAGH antibody was raised against the C terminal of HAGH

Purification: Affinity purified

Immunogen: HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAGH Blocking Peptide, catalog no. 33R-2847, is also available for use as a blocking control in assays to test for specificity of this HAGH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAGH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAGH

Target: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Alternative Name: HAGH (HAGH Products)

Synonyms: glo-2 antibody, glo2 antibody, glx2 antibody, glxii antibody, hagh1 antibody, DDBDRAFT_0186675 antibody, DDBDRAFT_0230988 antibody, DDB_0186675 antibody, DDB_0230988 antibody, DDBDRAFT_0183924 antibody, DDBDRAFT_0230991 antibody, DDB_0183924 antibody, DDB_0230991 antibody, BC019817 antibody, Glo-2 antibody, Glo2 antibody, Rsp29 antibody, RSP29 antibody, fa66a03 antibody, wu:fa66a03 antibody, zgc:73161 antibody, GLO2 antibody, GLX2 antibody, GLXII antibody, HAGH1 antibody, hydroxyacylglutathione hydrolase L homeolog antibody, hydroxyacylglutathione hydrolase antibody, beta-lactamase domain-containing protein antibody, hydroxyacyl glutathione hydrolase antibody, hagh.L antibody, CND02510 antibody, gloB1 antibody, gloB2 antibody, Fbal_1466 antibody, Hagh antibody, hagh antibody, HAGH antibody

Background: HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Molecular Weight: 29 kDa (MW of target protein)