ETF1 antibody (N-Term)

Catalog No. ABIN632229

Product Details anti-ETF1 Antibody

Target: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ETF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ETF1 antibody was raised against the N terminal of ETF1

Purification: Affinity purified

Immunogen: ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ETF1 Blocking Peptide, catalog no. 33R-4157, is also available for use as a blocking control in assays to test for specificity of this ETF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ETF1

Target: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Alternative Name: ETF1 (ETF1 Products)

Synonyms: D5S1995 antibody, ERF antibody, ERF1 antibody, RF1 antibody, SUP45L1 antibody, TB3-1 antibody, AI463371 antibody, D6Ertd109e antibody, eRF1 antibody, zeh0057 antibody, hm:zeh0057 antibody, wu:fa19e07 antibody, wu:fi31f01 antibody, cl1 antibody, RRF1 antibody, DDBDRAFT_0188023 antibody, DDBDRAFT_0191343 antibody, DDB_0188023 antibody, DDB_0191343 antibody, CG5605 antibody, Dm0184 antibody, Dmel\\CG5605 antibody, Group J antibody, group J antibody, l(3)00103 antibody, l(3)05637 antibody, l(3)77ABb antibody, l(3)neo28 antibody, Eukaryotic release factor 1 antibody, eukaryotic translation termination factor 1 antibody, eukaryotic translation termination factor 1b antibody, eukaryotic translation termination factor 1 S homeolog antibody, eukaryotic peptide chain release factor subunit 1 antibody, eukaryotic petide chain release factor subunit 1 antibody, eukaryotic release factor 1 antibody, Eukaryotic peptide chain release factor subunit 1 antibody, ETF1 antibody, Etf1 antibody, etf1b antibody, etf1 antibody, etf1.S antibody, Tb11.22.0012 antibody, THAPSDRAFT_22240 antibody, TTHERM_00292170 antibody, LOC692937 antibody, erf1 antibody, eRF1 antibody, erfa-1 antibody

Background: Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP.

Molecular Weight: 49 kDa (MW of target protein)