CK1 alpha 1 (C-Term) antibody
-
- Target
- CK1 alpha 1
- Binding Specificity
- C-Term
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Specificity
- CK1 alpha 1 antibody was raised against the C terminal of CSNK1 A1
- Purification
- Affinity purified
- Immunogen
- CK1 alpha 1 antibody was raised using the C terminal of CSNK1 A1 corresponding to a region with amino acids HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CK1 alpha 1 Blocking Peptide, catalog no. 33R-3833, is also available for use as a blocking control in assays to test for specificity of this CK1 alpha 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CK1 alpha 1
- Background
- CSNK1A1 belongs to the protein kinase superfamily. The function of the CSNK1A1 protein is not known.
- Molecular Weight
- 37 kDa (MW of target protein)
-