OCIAD2 antibody (Middle Region)
-
- Target See all OCIAD2 Antibodies
- OCIAD2 (OCIA Domain Containing 2 (OCIAD2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OCIAD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OCIAD2 antibody was raised against the middle region of OCIAD2
- Purification
- Affinity purified
- Immunogen
- OCIAD2 antibody was raised using the middle region of OCIAD2 corresponding to a region with amino acids QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG
- Top Product
- Discover our top product OCIAD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OCIAD2 Blocking Peptide, catalog no. 33R-7576, is also available for use as a blocking control in assays to test for specificity of this OCIAD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCIAD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OCIAD2 (OCIA Domain Containing 2 (OCIAD2))
- Alternative Name
- OCIAD2 (OCIAD2 Products)
- Synonyms
- 1810027I20Rik antibody, OCIA domain containing 2 L homeolog antibody, OCIA domain containing 2 antibody, ociad2.L antibody, OCIAD2 antibody, Ociad2 antibody
- Background
- The exact function of OCIAD2 is not known.
- Molecular Weight
- 17 kDa (MW of target protein)
-