OCIAD2 antibody (Middle Region)

Catalog No. ABIN632251

Product Details anti-OCIAD2 Antibody

Target: OCIAD2 (OCIA Domain Containing 2 (OCIAD2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OCIAD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OCIAD2 antibody was raised against the middle region of OCIAD2

Purification: Affinity purified

Immunogen: OCIAD2 antibody was raised using the middle region of OCIAD2 corresponding to a region with amino acids QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OCIAD2 Blocking Peptide, catalog no. 33R-7576, is also available for use as a blocking control in assays to test for specificity of this OCIAD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCIAD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OCIAD2

Target: OCIAD2 (OCIA Domain Containing 2 (OCIAD2))

Alternative Name: OCIAD2 (OCIAD2 Products)

Synonyms: 1810027I20Rik antibody, OCIA domain containing 2 L homeolog antibody, OCIA domain containing 2 antibody, ociad2.L antibody, OCIAD2 antibody, Ociad2 antibody

Background: The exact function of OCIAD2 is not known.

Molecular Weight: 17 kDa (MW of target protein)