ITPK1 antibody (Middle Region)

Catalog No. ABIN632257

Product Details anti-ITPK1 Antibody

Target: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITPK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ITPK1 antibody was raised against the middle region of ITPK1

Purification: Affinity purified

Immunogen: ITPK1 antibody was raised using the middle region of ITPK1 corresponding to a region with amino acids NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ITPK1 Blocking Peptide, catalog no. 33R-6637, is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITPK1

Target: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Alternative Name: ITPK1 (ITPK1 Products)

Synonyms: ITRPK1 antibody, BC031182 antibody, wu:fj15d08 antibody, zgc:56075 antibody, inositol-tetrakisphosphate 1-kinase antibody, inositol 1,3,4-triphosphate 5/6 kinase antibody, inositol-tetrakisphosphate 1-kinase L homeolog antibody, inositol-tetrakisphosphate 1-kinase a antibody, ITPK1 antibody, Itpk1 antibody, itpk1.L antibody, itpk1a antibody

Background: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3.

Molecular Weight: 45 kDa (MW of target protein)