TBCCD1 antibody (N-Term)

Catalog No. ABIN632270

Product Details anti-TBCCD1 Antibody

Target: TBCCD1 (TBCC Domain Containing 1 (TBCCD1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBCCD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TBCCD1 antibody was raised against the N terminal of TBCCD1

Purification: Affinity purified

Immunogen: TBCCD1 antibody was raised using the N terminal of TBCCD1 corresponding to a region with amino acids WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBCCD1 Blocking Peptide, catalog no. 33R-9990, is also available for use as a blocking control in assays to test for specificity of this TBCCD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBCCD1

Target: TBCCD1 (TBCC Domain Containing 1 (TBCCD1))

Alternative Name: TBCCD1 (TBCCD1 Products)

Synonyms: 5730478M09Rik antibody, AU015083 antibody, BB165076 antibody, Crygs antibody, si:ch211-194d6.5 antibody, zgc:162789 antibody, TBCC domain containing 1 antibody, TBCC domain containing 1 L homeolog antibody, TBCCD1 antibody, Tbccd1 antibody, tbccd1.L antibody, tbccd1 antibody

Background: The function of TBCCD1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 63 kDa (MW of target protein)