Proline Rich 13 antibody (Middle Region)

Catalog No. ABIN632300

The Rabbit Polyclonal anti-Proline Rich 13 antibody has been validated for WB. It is suitable to detect Proline Rich 13 in samples from Human.

Quick Overview for Proline Rich 13 antibody (Middle Region) (ABIN632300)

Target: Proline Rich 13 (PRR13)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Proline Rich 13 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Proline Rich 13 Antibody

Binding Specificity: Middle Region

Specificity: PRR13 antibody was raised against the middle region of PRR13

Purification: Affinity purified

Immunogen: PRR13 antibody was raised using the middle region of PRR13 corresponding to a region with amino acids PFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRR13 Blocking Peptide, (ABIN5615591), is also available for use as a blocking control in assays to test for specificity of this PRR13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Proline Rich 13

Target: Proline Rich 13 (PRR13)

Alternative Name: PRR13

Background: PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.

Molecular Weight: 15 kDa (MW of target protein)