serine Dehydratase antibody (Middle Region)
-
- Target See all serine Dehydratase (SDS) Antibodies
- serine Dehydratase (SDS)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This serine Dehydratase antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SDS antibody was raised against the middle region of SDS
- Purification
- Affinity purified
- Immunogen
- SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI
- Top Product
- Discover our top product SDS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SDS Blocking Peptide, catalog no. 33R-4446, is also available for use as a blocking control in assays to test for specificity of this SDS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- serine Dehydratase (SDS)
- Alternative Name
- SDS (SDS Products)
- Synonyms
- SDH antibody, RATSDHE1 antibody, SDH2 antibody, Sdh antibody, Sdhe1 antibody, TDH antibody, 4432411H13Rik antibody, sdh antibody, serine dehydratase antibody, serine dehydratase S homeolog antibody, SDS antibody, Sds antibody, sds.S antibody, sds antibody
- Background
- This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.
- Molecular Weight
- 34 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-