FBXL16 antibody (Middle Region)
-
- Target See all FBXL16 Antibodies
- FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXL16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXL16 antibody was raised against the middle region of FBXL16
- Purification
- Affinity purified
- Immunogen
- FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE
- Top Product
- Discover our top product FBXL16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXL16 Blocking Peptide, catalog no. 33R-3191, is also available for use as a blocking control in assays to test for specificity of this FBXL16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))
- Alternative Name
- FBXL16 (FBXL16 Products)
- Synonyms
- C16orf22 antibody, Fbl16 antibody, c380A1.1 antibody, BC042620 antibody, Scirr1 antibody, VIER F-box proteine 2 antibody, F-box and leucine rich repeat protein 16 antibody, fbxl16, putative antibody, F-box and leucine-rich repeat protein 16 antibody, VIER F-box protein 2 antibody, FBXL16 antibody, Smp_174380 antibody, fbxl16 antibody, Fbxl16 antibody, VFB2 antibody
- Background
- FBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.
- Molecular Weight
- 52 kDa (MW of target protein)
-