VPS52 antibody
-
- Target See all VPS52 Antibodies
- VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VPS52 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- VPS52 antibody was raised using a synthetic peptide corresponding to a region with amino acids RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF
- Top Product
- Discover our top product VPS52 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VPS52 Blocking Peptide, catalog no. 33R-8283, is also available for use as a blocking control in assays to test for specificity of this VPS52 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS52 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))
- Alternative Name
- VPS52 (VPS52 Products)
- Synonyms
- ARE1 antibody, RP5-1033B10 antibody, SAC2 antibody, SACM2L antibody, dJ1033B10.5 antibody, Are1 antibody, Sacm2l antibody, D130068D18 antibody, D430041K17Rik antibody, fb94c11 antibody, sacm2l antibody, wu:fb94c11 antibody, VPS52, GARP complex subunit antibody, VPS52 GARP complex subunit antibody, vacuolar protein sorting 52 homolog (S. cerevisiae) antibody, VPS52 antibody, Vps52 antibody, vps52 antibody
- Background
- This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.
- Molecular Weight
- 82 kDa (MW of target protein)
-