EXOC5 antibody (N-Term)

Catalog No. ABIN632393

Product Details anti-EXOC5 Antibody

Target: EXOC5 (Exocyst Complex Component 5 (EXOC5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOC5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EXOC5 antibody was raised against the N terminal of EXOC5

Purification: Affinity purified

Immunogen: EXOC5 antibody was raised using the N terminal of EXOC5 corresponding to a region with amino acids ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOC5 Blocking Peptide, catalog no. 33R-1562, is also available for use as a blocking control in assays to test for specificity of this EXOC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOC5

Target: EXOC5 (Exocyst Complex Component 5 (EXOC5))

Alternative Name: EXOC5 (EXOC5 Products)

Synonyms: CG6159 antibody, Dmel\\CG6159 antibody, P71 antibody, Sec10 antibody, Sec10p antibody, dSec10 antibody, dsec10 antibody, SEC10L1 antibody, MGC80624 antibody, sec10l1 antibody, zgc:175220 antibody, HSEC10 antibody, PRO1912 antibody, SEC10 antibody, SEC10P antibody, AI447711 antibody, AI448003 antibody, Gm76 antibody, Sec10l1 antibody, exocyst complex component sec10 antibody, Secretory 10 antibody, exocyst complex component 5 antibody, exocyst complex component 5 L homeolog antibody, exocyst complex component sec10 antibody, Exocyst complex component 5 antibody, Sec10 antibody, EXOC5 antibody, exoc5.L antibody, exoc5 antibody, CpipJ_CPIJ009626 antibody, Tsp_08508 antibody, Tsp_12387 antibody, Exoc5 antibody, SEC10 antibody, sec-10 antibody

Background: The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.

Molecular Weight: 82 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis