TTC23L antibody (N-Term)

Catalog No. ABIN632401

Product Details anti-TTC23L Antibody

Target: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTC23L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FLJ25439 antibody was raised against the N terminal Of Flj25439

Purification: Affinity purified

Immunogen: FLJ25439 antibody was raised using the N terminal Of Flj25439 corresponding to a region with amino acids MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ25439 Blocking Peptide, catalog no. 33R-6319, is also available for use as a blocking control in assays to test for specificity of this FLJ25439 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25439 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTC23L

Target: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Abstract: TTC23L Products

Synonyms: RGD1564928 antibody, MC25-1 antibody, 4930401A09Rik antibody, tetratricopeptide repeat domain 23 like antibody, tetratricopeptide repeat domain 23-like antibody, TTC23L antibody, Ttc23l antibody, ttc23l antibody

Background: The function of FLJ25439 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 41 kDa (MW of target protein)