HSPA6 antibody

Catalog No. ABIN632402

Product Details anti-HSPA6 Antibody

Target: HSPA6 (Heat Shock 70kDa Protein 6 (HSP70B') (HSPA6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPA6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA6 Blocking Peptide, catalog no. 33R-2819, is also available for use as a blocking control in assays to test for specificity of this HSPA6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPA6

Target: HSPA6 (Heat Shock 70kDa Protein 6 (HSP70B') (HSPA6))

Alternative Name: HSPA6 (HSPA6 Products)

Synonyms: HSPA6 antibody, HSP70B' antibody, heat shock protein family A (Hsp70) member 6 antibody, HSPA6 antibody

Background: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognise nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Molecular Weight: 71 kDa (MW of target protein)