CMTR2 antibody (Middle Region)
-
- Target See all CMTR2 products
- CMTR2 (Cap Methyltransferase 2 (CMTR2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CMTR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FTSJD1 antibody was raised against the middle region of FTSJD1
- Purification
- Affinity purified
- Immunogen
- FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FTSJD1 Blocking Peptide, catalog no. 33R-5216, is also available for use as a blocking control in assays to test for specificity of this FTSJD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CMTR2 (Cap Methyltransferase 2 (CMTR2))
- Alternative Name
- FTSJD1 (CMTR2 Products)
- Synonyms
- AFT antibody, FTSJD1 antibody, MTr2 antibody, cap methyltransferase 2 antibody, CMTR2 antibody
- Background
- The function of FTSJ protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 88 kDa (MW of target protein)
-