AHCYL1 antibody (N-Term)
-
- Target See all AHCYL1 Antibodies
- AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AHCYL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AHCYL1 antibody was raised against the N terminal of AHCYL1
- Purification
- Affinity purified
- Immunogen
- AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE
- Top Product
- Discover our top product AHCYL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AHCYL1 Blocking Peptide, catalog no. 33R-6472, is also available for use as a blocking control in assays to test for specificity of this AHCYL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCYL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))
- Alternative Name
- AHCYL1 (AHCYL1 Products)
- Synonyms
- irbit antibody, DCAL antibody, IRBIT antibody, PRO0233 antibody, XPVKONA antibody, cb586 antibody, wu:fj66f02 antibody, 1110034F20Rik antibody, AA409031 antibody, AA414901 antibody, Ahcy-rs3 antibody, Irbit antibody, adenosylhomocysteinase like 1 antibody, adenosylhomocysteinase like 1 S homeolog antibody, adenosylhomocysteinase-like 1 antibody, S-adenosylhomocysteine hydrolase-like 1 antibody, AHCYL1 antibody, ahcyl1 antibody, ahcyl1.S antibody, Ahcyl1 antibody
- Background
- AHCYL1 belongs to the adenosylhomocysteinase family.
- Molecular Weight
- 59 kDa (MW of target protein)
-