FAM50B antibody (N-Term)

Catalog No. ABIN632462

Product Details anti-FAM50B Antibody

Target: FAM50B (Family with Sequence Similarity 50, Member B (FAM50B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM50B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM50 B antibody was raised against the N terminal of FAM50

Purification: Affinity purified

Immunogen: FAM50 B antibody was raised using the N terminal of FAM50 corresponding to a region with amino acids EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM50B Blocking Peptide, catalog no. 33R-2677, is also available for use as a blocking control in assays to test for specificity of this FAM50B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM50B

Target: FAM50B (Family with Sequence Similarity 50, Member B (FAM50B))

Alternative Name: FAM50B (FAM50B Products)

Synonyms: RGD1563458 antibody, D6S2654E antibody, X5L antibody, D0H6S2654E antibody, XAP-5-like antibody, family with sequence similarity 50, member B antibody, family with sequence similarity 50 member B antibody, Fam50b antibody, FAM50B antibody

Background: FAM50B may be involved in growth regulation.

Molecular Weight: 39 kDa (MW of target protein)