TRAPPC2L antibody (N-Term)

Catalog No. ABIN632473

Product Details anti-TRAPPC2L Antibody

Target: TRAPPC2L

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAPPC2L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRAPPC2 L antibody was raised against the N terminal of TRAPPC2

Purification: Affinity purified

Immunogen: TRAPPC2 L antibody was raised using the N terminal of TRAPPC2 corresponding to a region with amino acids MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAPPC2L Blocking Peptide, catalog no. 33R-5796, is also available for use as a blocking control in assays to test for specificity of this TRAPPC2L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAPPC2L

Target: TRAPPC2L

Abstract: TRAPPC2L Products

Synonyms: HSPC176 antibody, DDBDRAFT_0184526 antibody, DDBDRAFT_0266384 antibody, DDB_0184526 antibody, DDB_0266384 antibody, DKFZp469K0715 antibody, 1810017G16Rik antibody, AB030200 antibody, Hspc176 antibody, Tca17 antibody, RGD1304906 antibody, zgc:172319 antibody, zgc:92446 antibody, TPC2L antibody, trappc2l antibody, trafficking protein particle complex 2 like antibody, trafficking protein particle complex subunit 2-like protein antibody, trafficking protein particle complex 2-like antibody, trafficking protein particle complex 2-like L homeolog antibody, TRAPPC2L antibody, trappc2l antibody, Trappc2l antibody, LOC106562066 antibody, trappc2l.L antibody

Background: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Molecular Weight: 16 kDa (MW of target protein)