RSL24D1 antibody (Middle Region)
-
- Target See all RSL24D1 Antibodies
- RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RSL24D1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C15 ORF15 antibody was raised against the middle region of C15 rf15
- Purification
- Affinity purified
- Immunogen
- C15 ORF15 antibody was raised using the middle region of C15 rf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED
- Top Product
- Discover our top product RSL24D1 Primary Antibody
-
-
- Application Notes
-
WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C15ORF15 Blocking Peptide, catalog no. 33R-2931, is also available for use as a blocking control in assays to test for specificity of this C15ORF15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))
- Alternative Name
- C15ORF15 (RSL24D1 Products)
- Synonyms
- C15orf15 antibody, HRP-L30-iso antibody, L30 antibody, RLP24 antibody, RPL24 antibody, RPL24L antibody, TVAS3 antibody, 2410159K22Rik antibody, RGD1309784 antibody, c15orf15 antibody, wu:fa94f12 antibody, wu:fa95d02 antibody, zgc:56202 antibody, ribosomal L24 domain containing 1 antibody, RSL24D1 antibody, Rsl24d1 antibody, rsl24d1 antibody
- Background
- The function of Chromosome 15 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 19 kDa (MW of target protein)
-