GPR87 antibody (N-Term)
-
- Target See all GPR87 Antibodies
- GPR87 (G Protein-Coupled Receptor 87 (GPR87))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPR87 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GPR87 antibody was raised against the N terminal of GPR87
- Purification
- Affinity purified
- Immunogen
- GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL
- Top Product
- Discover our top product GPR87 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPR87 Blocking Peptide, catalog no. 33R-6027, is also available for use as a blocking control in assays to test for specificity of this GPR87 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR87 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR87 (G Protein-Coupled Receptor 87 (GPR87))
- Alternative Name
- GPR87 (GPR87 Products)
- Synonyms
- GPR95 antibody, KPG_002 antibody, G protein-coupled receptor 87 antibody, GPR87 antibody, Gpr87 antibody
- Background
- G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-