GPR87 antibody (N-Term)

Catalog No. ABIN632486

Product Details anti-GPR87 Antibody

Target: GPR87 (G Protein-Coupled Receptor 87 (GPR87))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPR87 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GPR87 antibody was raised against the N terminal of GPR87

Purification: Affinity purified

Immunogen: GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPR87 Blocking Peptide, catalog no. 33R-6027, is also available for use as a blocking control in assays to test for specificity of this GPR87 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR87 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPR87

Target: GPR87 (G Protein-Coupled Receptor 87 (GPR87))

Alternative Name: GPR87 (GPR87 Products)

Synonyms: GPR95 antibody, KPG_002 antibody, G protein-coupled receptor 87 antibody, GPR87 antibody, Gpr87 antibody

Background: G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: cAMP Metabolic Process