Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) antibody
-
- Target See all Chromosome 6 Open Reading Frame 134 (C6orf134) Antibodies
- Chromosome 6 Open Reading Frame 134 (C6orf134)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C6 orf134 antibody was raised against the N terminal of C6 rf134
- Purification
- Affinity purified
- Immunogen
- C6 orf134 antibody was raised using the N terminal of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
- Top Product
- Discover our top product C6orf134 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C6orf134 Blocking Peptide, catalog no. 33R-5914, is also available for use as a blocking control in assays to test for specificity of this C6orf134 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf134 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Chromosome 6 Open Reading Frame 134 (C6orf134)
- Alternative Name
- C6orf134 (C6orf134 Products)
- Synonyms
- C6orf134 antibody, MEC17 antibody, Nbla00487 antibody, TAT antibody, mec17 antibody, wu:fj19c03 antibody, zgc:65893 antibody, zgc:77443 antibody, Alpha-TAT antibody, c6orf134 antibody, C23H6orf134 antibody, 0610011P08Rik antibody, 2610008K08Rik antibody, 2610110G12Rik antibody, 3110080J08Rik antibody, Mec17 antibody, RGD1303066 antibody, C7H6ORF134 antibody, C4H6orf134 antibody, alpha tubulin acetyltransferase 1 antibody, alpha tubulin acetyltransferase 1 S homeolog antibody, ATAT1 antibody, atat1 antibody, atat1.S antibody, Atat1 antibody
- Background
- The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 36 kDa (MW of target protein)
-