TNNI3K antibody (N-Term)

Catalog No. ABIN632533

Product Details anti-TNNI3K Antibody

Target: TNNI3K (TNNI3 Interacting Kinase (TNNI3K))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNNI3K antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TNNI3 K antibody was raised against the N terminal of TNNI3

Purification: Affinity purified

Immunogen: TNNI3 K antibody was raised using the N terminal of TNNI3 corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TNNI3K Blocking Peptide, catalog no. 33R-5154, is also available for use as a blocking control in assays to test for specificity of this TNNI3K antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNNI3K

Target: TNNI3K (TNNI3 Interacting Kinase (TNNI3K))

Alternative Name: TNNI3K (TNNI3K Products)

Synonyms: CARK antibody, Cark antibody, D830019J24Rik antibody, TNNI3 interacting kinase antibody, serine/threonine-protein kinase TNNI3K antibody, TNNI3K antibody, LOC100592286 antibody, Tnni3k antibody

Background: TNNI3K may play a role in cardiac physiology.

Molecular Weight: 103 kDa (MW of target protein)