DPH1 antibody
-
- Target See all DPH1 Antibodies
- DPH1 (DPH1 Homolog (DPH1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DPH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG
- Top Product
- Discover our top product DPH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DPH1 Blocking Peptide, catalog no. 33R-6839, is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPH1 (DPH1 Homolog (DPH1))
- Alternative Name
- DPH1 (DPH1 Products)
- Background
- Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A.
- Molecular Weight
- 49 kDa (MW of target protein)
-