WFDC1 antibody (Middle Region)

Catalog No. ABIN632551

Product Details anti-WFDC1 Antibody

Target: WFDC1 (WAP Four-Disulfide Core Domain 1 (WFDC1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WFDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WFDC1 antibody was raised against the middle region of WFDC1

Purification: Affinity purified

Immunogen: WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WFDC1 Blocking Peptide, catalog no. 33R-9410, is also available for use as a blocking control in assays to test for specificity of this WFDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WFDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WFDC1

Target: WFDC1 (WAP Four-Disulfide Core Domain 1 (WFDC1))

Alternative Name: WFDC1 (WFDC1 Products)

Synonyms: WFDC1 antibody, zgc:158671 antibody, PS20 antibody, 2310058A03Rik antibody, ps20 antibody, WAP four-disulfide core domain 1 antibody, WFDC1 antibody, wfdc1 antibody, Wfdc1 antibody

Background: This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene.

Molecular Weight: 21 kDa (MW of target protein)